Structure of PDB 7dz8 Chain U

Receptor sequence

>7dz8U (length=219) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

EFYGPNRAKWLGPYSENATPAYLTGEFPGDYGWDTAGLSADPETFKRYRE
LELIHARWAMLGALGCITPELLAKSGTQFGEAVWFKAGAQIFSEGGLDYL
GNPSLVHAQNIVATLAVQVILMGLVEGYRVNGGPAGEGLDPLYPGESFDP
LGLADDPDTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIQNLDDHL
SNPTVNNAFAFATKFTPSA

3D structure

PDB

7dz8 Structural basis of LhcbM5-mediated state transitions in green algae.

Chain

Resolution

3.16 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	U	K47 W48 L49 P51 Y52 Y69 W71	K9 W10 L11 P13 Y14 Y31 W33
BS02	CLA	U	G67 D68 Y69 W71 D72 L76 S77 Y86 R87 L89 E90 R210 M213	G29 D30 Y31 W33 D34 L38 S39 Y48 R49 L51 E52 R172 M175
BS03	CLA	U	Y86 H93	Y48 H55
BS04	CLA	U	L99 G103 P107 F117 Q128 Y137	L61 G65 P69 F79 Q90 Y99
BS05	CHL	U	S142 L143 V144 H145 Q147	S104 L105 V106 H107 Q109
BS06	CHL	U	W96 Q156	W58 Q118
BS07	CHL	U	W122 F123 K124 G126 L153 F220	W84 F85 K86 G88 L115 F182
BS08	CHL	U	R95 W96 V163 Y166 R167 G170 G171 P172 A173 F186	R57 W58 V125 Y128 R129 G132 G133 P134 A135 F148
BS09	CHL	U	L89 I92 H93 W96 Q156 M160 G161 E164 R167	L51 I54 H55 W58 Q118 M122 G123 E126 R129
BS10	CLA	U	R95 M98 Y181 P182 G183 F186 L191 F198 L201 K202 E205	R57 M60 Y143 P144 G145 F148 L153 F160 L163 K164 E167
BS11	CLA	U	F40 K204 K207 N208 L211	F2 K166 K169 N170 L173
BS12	CLA	U	F214 F217 G218 V221 Q222 T226 N233 H237 N245 A246	F176 F179 G180 V183 Q184 T188 N195 H199 N207 A208
BS13	CLA	U	H237 P241 N245	H199 P203 N207
BS14	CLA	U	V150 L153	V112 L115
BS15	CHL	U	F247 A250 F253	F209 A212 F215
BS16	CHL	U	W71 T73	W33 T35

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7dz8, PDBe:7dz8, PDBj:7dz8
PDBsum	7dz8
PubMed	34239095
UniProt	Q93WL4

[Back to BioLiP]