Structure of PDB 7c52 Chain U

Receptor sequence

>7c52U (length=58) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]

TMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIP
VSYQALGK

3D structure

PDB

7c52 Crystal structure of a photosynthetic LH1-RC in complex with its electron donor HiPIP.

Chain

Resolution

2.89 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	U	Q28 H36 W46	Q26 H34 W44
BS02	CA	U	W46 D49 I51	W44 D47 I49
BS03	BCL	U	Q28 L31 G32 I35 H36	Q26 L29 G30 I33 H34
BS04	CRT	U	I24 F27 L31	I22 F25 L29
BS05	CRT	U	K10 I11	K8 I9

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0019866	organelle inner membrane
GO:0030076	light-harvesting complex
GO:0030077	plasma membrane light-harvesting complex

External links