Structure of PDB 7b0n Chain U

Receptor sequence

>7b0nU (length=88) Species: 4952 (Yarrowia lipolytica)

SSAHVLTKDMIQERIVALLESFDKVNDAKNITATANLTSDLGLDSLDVVE
VVMAIEEEFGLEIPDHDADEIKTVQQAIDYVSAQPAAV

3D structure

• PDB: 7b0n A conserved arginine residue is critical for stabilizing the N2 FeS cluster in mitochondrial complex I.
• Chain: U
• Resolution: 3.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D88
• Catalytic site (residue number reindexed from 1): D44

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EHZ	U	D88 S89	D44 S45

Gene Ontology

Biological Process

• GO:0006633 fatty acid biosynthetic process

External links

• PDB: RCSB:7b0n, PDBe:7b0n, PDBj:7b0n
• PDBsum: 7b0n
• PubMed: 33640456
• UniProt: A0A1D8NG21