Structure of PDB 7aqd Chain U

Receptor sequence

>7aqdU (length=100) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

HVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQAN
PQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQVL

3D structure

• PDB: 7aqd Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
• Chain: U
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	H2 K4 K5 M10 G14 K15 A26 K29 H44 S45 P47 H64 S66 N67 M69 V78 R80 Y83 K89 K90 K95	H1 K3 K4 M9 G13 K14 A25 K28 H43 S44 P46 H63 S65 N66 M68 V77 R79 Y82 K88 K89 K94

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0009295 nucleoid
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7aqd, PDBe:7aqd, PDBj:7aqd
• PDBsum: 7aqd
• PubMed: 33259811
• UniProt: P0CI78|RL24_BACSU Large ribosomal subunit protein uL24 (Gene Name=rplX)