Structure of PDB 6wdr Chain U

Receptor sequence
>6wdrU (length=103) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IIKIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTR
KTPNGEGSKTWETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVVV
ASN
3D structure
PDB6wdr An open interface in the pre-80S ribosome coordinated by ribosome assembly factors Tsr1 and Dim1 enables temporal regulation of Fap7.
ChainU
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U R23 K53 G54 R57 L58 P59 T67 R68 K69 T70 P71 G73 E74 S76 W79 R85 H87 K88 Y90 R5 K35 G36 R39 L40 P41 T49 R50 K51 T52 P53 G55 E56 S58 W61 R67 H69 K70 Y72
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6wdr, PDBe:6wdr, PDBj:6wdr
PDBsum6wdr
PubMed33219089
UniProtP38701|RS20_YEAST Small ribosomal subunit protein uS10 (Gene Name=RPS20)

[Back to BioLiP]