Structure of PDB 6swe Chain U

Receptor sequence
>6sweU (length=149) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
ATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDWW
YYRVASILRRVYLDGPVGIERLRTYYGGRKNRGHAPERFYKAGGSIIRKA
LQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEIIPELKKY
3D structure
PDB6swe Cryo-EM study of an archaeal 30S initiation complex gives insights into evolution of translation initiation.
ChainU
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U D10 R39 K41 R43 P45 E46 Q47 S57 G69 I70 E71 R72 Y76 R80 R83 H85 P87 F90 S96 R99 R119 S127 D130 K131 K138 D9 R38 K40 R42 P44 E45 Q46 S56 G68 I69 E70 R71 Y75 R79 R82 H84 P86 F89 S95 R98 R118 S126 D129 K130 K137
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6swe, PDBe:6swe, PDBj:6swe
PDBsum6swe
PubMed32029867
UniProtQ9V0G8|RS19E_PYRAB Small ribosomal subunit protein eS19 (Gene Name=rps19e)

[Back to BioLiP]