Structure of PDB 6snt Chain U

Receptor sequence
>6sntU (length=100) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IKIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRK
TPNGEGSKTWETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVVVA
3D structure
PDB6snt RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.
ChainU
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U R23 G54 R57 L58 P59 T60 K61 S66 T67 R68 K69 N72 G73 E74 G75 S76 K77 T78 W79 R85 H87 K88 R89 Y90 R4 G35 R38 L39 P40 T41 K42 S47 T48 R49 K50 N53 G54 E55 G56 S57 K58 T59 W60 R66 H68 K69 R70 Y71
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6snt, PDBe:6snt, PDBj:6snt
PDBsum6snt
PubMed32203490
UniProtP38701|RS20_YEAST Small ribosomal subunit protein uS10 (Gene Name=RPS20)

[Back to BioLiP]