Structure of PDB 6s12 Chain U

Receptor sequence

>6s12U (length=82) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

KKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGR
GGDDTLFAKIDGVVKFERKGRDKKQVSVYAVA

3D structure

PDB

6s12 Exit tunnel modulation as resistance mechanism of S. aureus erythromycin resistant mutant.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	K12 K13 G14 V15 S16 S17 N20 R22 D23 S24 E25 S26 K27 R28 K32 R33 T40 G41 G42 S43 I44 R47 R49 T51 K52 Y54 G62 G63 T66 F68 K70 K85	K1 K2 G3 V4 S5 S6 N9 R11 D12 S13 E14 S15 K16 R17 K21 R22 T29 G30 G31 S32 I33 R36 R38 T40 K41 Y43 G51 G52 T55 F57 K59 K74
BS02	rna	U	R79 R82	R68 R71

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links