Structure of PDB 6q95 Chain U

Receptor sequence
>6q95U (length=100) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
3D structure
PDB6q95 How a circularized tmRNA moves through the ribosome.
ChainU
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U R2 V7 K9 S17 G18 K19 K21 V30 P32 Y35 I44 V45 K47 V49 Q57 H68 S70 K71 R73 R84 V85 R1 V6 K8 S16 G17 K18 K20 V29 P31 Y34 I43 V44 K46 V48 Q56 H67 S69 K70 R72 R83 V84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6q95, PDBe:6q95, PDBj:6q95
PDBsum6q95
PubMed30765567
UniProtQ5SHP9|RL24_THET8 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]