Structure of PDB 6pfy Chain U

Receptor sequence

>6pfyU (length=151) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

LVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMA
HGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQK
GGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFLVVDGIMTGLF
N

3D structure

PDB

6pfy Membrane protein megahertz crystallography at the European XFEL.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CA	U	P67 D70	P64 D67
BS02	CLA	U	F30 N33 L34 R38 E49 M52 A53	F27 N30 L31 R35 E46 M49 A50
BS03	CLA	U	I21 F30 P35 H54 F57	I18 F27 P32 H51 F54
BS04	CLA	U	Y56 F57 G60 P61 K64 L138 V145	Y53 F54 G57 P58 K61 L135 V142
BS05	CLA	U	H16 L17 T19 I21 S22	H13 L14 T16 I18 S19
BS06	CLA	U	P61 W62 L65 G66 P67	P58 W59 L62 G63 P64
BS07	CLA	U	V5 T19	V2 T16
BS08	CLA	U	W62 P67 I80 S81	W59 P64 I77 S78

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6pfy, PDBe:6pfy, PDBj:6pfy
PDBsum	6pfy
PubMed	31685819
UniProt	Q8DGB4\|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]