Structure of PDB 6kif Chain U

Receptor sequence
>6kifU (length=78) Species: 1140 (Synechococcus elongatus PCC 7942 = FACHB-805) [Search protein sequence]
AIPQTVAWSPKVALVMILSNIVAIAIGKATIKIQNAGPALPSPQLFGGFG
LPAVLATASFGHILGIGVILGLANIGNL
3D structure
PDB6kif Structural basis for energy and electron transfer of the photosystem I-IsiA-flavodoxin supercomplex.
ChainU
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA U P9 L76 P3 L70
BS02 CLA U L61 A62 L55 A56
BS03 CLA U T36 K38 T30 K32
BS04 CLA U G73 V74 G77 N80 G67 V68 G71 N74
BS05 CLA U W14 M22 I23 N26 H68 W8 M16 I17 N20 H62
BS06 CLA U I30 K34 L51 F52 F55 V60 I24 K28 L45 F46 F49 V54
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kif, PDBe:6kif, PDBj:6kif
PDBsum6kif
PubMed32042157
UniProtQ31PR9

[Back to BioLiP]