Structure of PDB 6htq Chain U

Receptor sequence
>6htqU (length=101) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MHVKKGDKVMVISGKDKGKQGTILAAFPKKDRVLVEGVNMVKKHSKPTQA
NPQGGISNQEAPIHVSNVMPLDPKTGEVTRVGYKVEDGKKVRVAKKSGQV
L
3D structure
PDB6htq Structural Basis for Regulation of the Opposing (p)ppGpp Synthetase and Hydrolase within the Stringent Response Orchestrator Rel.
ChainU
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U H2 K5 I12 G14 K15 K17 P28 K29 R32 V41 K43 H44 S45 K46 P47 G54 G55 I56 H64 S66 R80 G82 Y83 K89 K90 K95 K96 H2 K5 I12 G14 K15 K17 P28 K29 R32 V41 K43 H44 S45 K46 P47 G54 G55 I56 H64 S66 R80 G82 Y83 K89 K90 K95 K96
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0009295 nucleoid
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6htq, PDBe:6htq, PDBj:6htq
PDBsum6htq
PubMed32937119
UniProtP0CI78|RL24_BACSU Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]