Structure of PDB 6fai Chain U

Receptor sequence
>6faiU (length=103) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IIKIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTR
KTPNGEGSKTWETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVVV
ASN
3D structure
PDB6fai Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
ChainU
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U R23 V31 K53 V56 R57 L58 P59 T60 S66 R68 N72 W79 R85 H87 R89 Y90 R5 V13 K35 V38 R39 L40 P41 T42 S48 R50 N54 W61 R67 H69 R71 Y72
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6fai, PDBe:6fai, PDBj:6fai
PDBsum6fai
PubMed29459436
UniProtP38701|RS20_YEAST Small ribosomal subunit protein uS10 (Gene Name=RPS20)

[Back to BioLiP]