Structure of PDB 5xtc Chain U |
>5xtcU (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] |
AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPY NYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL |
|
PDB | 5xtc Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2. |
Chain | U |
Resolution | 3.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PLX |
U |
E16 F23 G26 |
E15 F22 G25 |
|
|
|
|