Structure of PDB 5x8p Chain U

Receptor sequence
>5x8pU (length=92) Species: 3562 (Spinacia oleracea) [Search protein sequence]
LKYPRRILDVYQILQSPIITEAAIKNIADENSLLFTVDVRADKKMIREAI
SNFFGVKVRKVNTLIRPDGTKKAYIMLNKEYNASELAKKIGI
3D structure
PDB5x8p Unique localization of the plastid-specific ribosomal proteins in the chloroplast ribosome small subunit provides mechanistic insights into the chloroplastic translation
ChainU
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U Y104 R106 R107 Q113 E131 R141 D143 K144 K145 R148 R160 N163 T164 L165 I166 P168 K172 K173 Y175 Y3 R5 R6 Q12 E30 R40 D42 K43 K44 R47 R59 N62 T63 L64 I65 P67 K71 K72 Y74
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5x8p, PDBe:5x8p, PDBj:5x8p
PDBsum5x8p
PubMed28582576
UniProtQ9LWB5|RK23_SPIOL Large ribosomal subunit protein uL23c (Gene Name=RPL23)

[Back to BioLiP]