Structure of PDB 5v7q Chain U

Receptor sequence
>5v7qU (length=90) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
MKVHKGDTVLVISGKDKGAKGKVLQAYPDRNRVLVEGVNRIKKHTATQEA
PIHVSNVMVVDSDGKPTRIGYRVDEETGKRVRISKRNGKD
3D structure
PDB5v7q Structural insights into species-specific features of the ribosome from the human pathogen Mycobacterium tuberculosis.
ChainU
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U K2 H4 K5 G14 P28 I41 K43 T45 H67 S69 N70 K79 R82 G84 Y85 R94 K99 K2 H4 K5 G14 P28 I41 K43 T45 H53 S55 N56 K65 R68 G70 Y71 R80 K85
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0009274 peptidoglycan-based cell wall
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5v7q, PDBe:5v7q, PDBj:5v7q
PDBsum5v7q
PubMed28977617
UniProtP9WHB7|RL24_MYCTU Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]