Structure of PDB 5uyq Chain U

Receptor sequence
>5uyqU (length=65) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAV
KRHAKKLARENARRT
3D structure
PDB5uyq Ensemble cryo-EM elucidates the mechanism of translation fidelity
ChainU
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U R17 Y37 E38 K39 R44 K48 A49 V52 R65 T67 R15 Y35 E36 K37 R42 K46 A47 V50 R63 T65
BS02 rna U K24 A25 G26 K22 A23 G24
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uyq, PDBe:5uyq, PDBj:5uyq
PDBsum5uyq
PubMed28538735
UniProtP68679|RS21_ECOLI Small ribosomal subunit protein bS21 (Gene Name=rpsU)

[Back to BioLiP]