Structure of PDB 5umd Chain U

Receptor sequence

>5umdU (length=180) Species: 36329 (Plasmodium falciparum 3D7)

IDNSLNTNIHQYHIVGRAIPTAKDKNPNVYRMCIFAKNDTNAKSRFWYFM
KKINKLKKSNGELLACEQIKERFPLRVKNYGVLLRYDSRTGTHNMYKEFR
DTTKEGAIAQLYSEMAGRHRARASSINIIRISEISSSLVRRPHIKQLLKR
RLRFPALHLPTLQKEYRKKFASKRPSTYRM

3D structure

• PDB: 5umd Mefloquine targets the Plasmodium falciparum 80S ribosome to inhibit protein synthesis.
• Chain: U
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	S8 N12 K41 F77 R80 S92 R93 T94 H97 M99 Y100 S117 E118 A120 G121 R122 H123 R124 R126 E137 S139 R145 K153 R154 R155 R157 L161 L163 K168 Y170 R171 K172 S176 R178 P179 S180 T181 Y182 R183 M184	S4 N8 K37 F73 R76 S88 R89 T90 H93 M95 Y96 S113 E114 A116 G117 R118 H119 R120 R122 E133 S135 R141 K149 R150 R151 R153 L157 L159 K164 Y166 R167 K168 S172 R174 P175 S176 T177 Y178 R179 M180
BS02	rna	U	R49 Y52 K55 K56 I57 K59 K61 S63 R93 R126 S128	R45 Y48 K51 K52 I53 K55 K57 S59 R89 R122 S124

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5umd, PDBe:5umd, PDBj:5umd
• PDBsum: 5umd
• PubMed: 28288098
• UniProt: Q8IDS6