Structure of PDB 5sva Chain U

Receptor sequence
>5svaU (length=156) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SLYPPPPPYVKFFTQSNLEKLPKYKEKKAAEEITCALDYLIPPPMPKNQQ
YRAFGSIWESTNYQYKIQELRKLLKSLLLNYLELIGVLSINPDMYERKVE
NIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIEQVCKQV
HDKLTS
3D structure
PDB5sva Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
ChainU
Resolution15.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide U F23 T24 Q25 S26 F13 T14 Q15 S16
Gene Ontology
Molecular Function
GO:0003712 transcription coregulator activity
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006357 regulation of transcription by RNA polymerase II
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0016592 mediator complex
GO:0070847 core mediator complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5sva, PDBe:5sva, PDBj:5sva
PDBsum5sva
PubMed27610567
UniProtQ08278|MED7_YEAST Mediator of RNA polymerase II transcription subunit 7 (Gene Name=MED7)

[Back to BioLiP]