Structure of PDB 5nrl Chain U

Receptor sequence
>5nrlU (length=196) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
LSKGENVPYTFQDEQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLG
GKKHGLNVLRRGISIEKSSDFRQQQKIIEAKQSLKNNGTIPGSVGLAIQV
NYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFE
NIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQ
3D structure
PDB5nrl Structure of a pre-catalytic spliceosome.
ChainU
Resolution7.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U T73 M74 H75 S80 R83 H84 G87 K88 K89 T37 M38 H39 S44 R47 H48 G51 K52 K53
BS02 rna U C71 M76 S77 C35 M40 S41
BS03 ZN U C68 C71 H84 H90 C32 C35 H48 H54
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nrl, PDBe:5nrl, PDBj:5nrl
PDBsum5nrl
PubMed28530653
UniProtQ07350|PRP11_YEAST Pre-mRNA-splicing factor PRP11 (Gene Name=PRP11)

[Back to BioLiP]