Structure of PDB 5nb4 Chain U

Receptor sequence

>5nb4U (length=184) Species: 865859 (Phormidium rubidum A09DM) [Search protein sequence]

MLDAFSRAVVQADASTSVVADMGALKQFIAEGNRRLDAVNAIASNASCMV
SDAVAGMICENQGLIQAGGNCYPNRRMAACLRDAEIILRYVTYALLAGDA
SVLDDRCLNGLKETYAALGVPTTSTVRAVQIMKAQAAAHIKDTPSEARAG
GKLRKMGSPVVEDRCASLVAEASSYFDRVISALS

3D structure

PDB

5nb4 An improved crystal structure of C-phycoerythrin from the marine cyanobacterium Phormidium sp. A09DM.

Chain

Resolution

1.14 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	U	I65 Y72 P73 N74 M77	I65 Y72 P73 N74 M77
BS02	PEB	U	M57 N70 C71 R75 R76 A79 C80 R82 D83 I86 L111 L118 V120 S124 T125	M57 N70 C71 R75 R76 A79 C80 R82 D83 I86 L111 L118 V120 S124 T125
BS03	PEB	U	N33 R34 L36 D37 I140 K141 S158 P159 V160 V161 C165	N33 R34 L36 D37 I140 K141 S158 P159 V160 V161 C165
BS04	PEB	U	C48 D52 A55 G56 C59 R127 Q135 H139 P144 S145 R148 A149 K152	C48 D52 A55 G56 C59 R127 Q135 H139 P144 S145 R148 A149 K152

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5nb4, PDBe:5nb4, PDBj:5nb4
PDBsum	5nb4
PubMed	28918447
UniProt	A0A0E4G455

[Back to BioLiP]