Structure of PDB 5nb3 Chain U

Receptor sequence

>5nb3U (length=184) Species: 865859 (Phormidium rubidum A09DM) [Search protein sequence]

MLDAFSRAVVQADASTSVVADMGALKQFIAEGNRRLDAVNAIASNASCMV
SDAVAGMICENQGLIQAGGNCYPNRRMAACLRDAEIILRYVTYALLAGDA
SVLDDRCLNGLKETYAALGVPTTSTVRAVQIMKAQAAAHIKDTPSEARAG
GKLRKMGSPVVEDRCASLVAEASSYFDRVISALS

3D structure

PDB

5nb3 An improved crystal structure of C-phycoerythrin from the marine cyanobacterium Phormidium sp. A09DM.

Chain

Resolution

1.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	U	I65 Y72 P73 N74 M77	I65 Y72 P73 N74 M77
BS02	PEB	U	M57 N70 C71 R75 R76 A79 C80 R82 D83 I86 L111 L118 T125	M57 N70 C71 R75 R76 A79 C80 R82 D83 I86 L111 L118 T125
BS03	PEB	U	N33 R34 L36 D37 I140 K141 S158 P159 V160 V161 C165	N33 R34 L36 D37 I140 K141 S158 P159 V160 V161 C165
BS04	PEB	U	C48 D52 G56 C59 R127 Q135 H139 P144 S145 R148 A149 K152	C48 D52 G56 C59 R127 Q135 H139 P144 S145 R148 A149 K152

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5nb3, PDBe:5nb3, PDBj:5nb3
PDBsum	5nb3
PubMed	28918447
UniProt	A0A0E4G455

[Back to BioLiP]