Structure of PDB 5jbh Chain U

Receptor sequence

>5jbhU (length=144) Species: 272844 (Pyrococcus abyssi GE5)

MATVYDVPGDLLVERVAQRLKEIPEIKPPEWAPFVKTGRHKERLPEQEDW
WYYRVASILRRVYLDGPVGIERLRTYYGGRKNRGHAPEKFYKAGGSIIRK
ALQQLEAAGFVEKVPGKGRVITPKGRSFLDKIATELKKELEEII

3D structure

• PDB: 5jbh Cryo-EM study of start codon selection during archaeal translation initiation.
• Chain: U
• Resolution: 5.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	M1 T3 Y5 D6 G9 V13 K36 R39 H40 K41 E42 Y53 R54 S57 R60 R61 P67 G69 I70 E71 R72 R74 T75 Y76 R80 K81 N82 R83 H85 A86 P87 K89 F90 Y91 G95 S96 R99 Q103 K113 K117 G118 R119 R126 S127 D130 K138	M1 T3 Y5 D6 G9 V13 K36 R39 H40 K41 E42 Y53 R54 S57 R60 R61 P67 G69 I70 E71 R72 R74 T75 Y76 R80 K81 N82 R83 H85 A86 P87 K89 F90 Y91 G95 S96 R99 Q103 K113 K117 G118 R119 R126 S127 D130 K138

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5jbh, PDBe:5jbh, PDBj:5jbh
• PDBsum: 5jbh
• PubMed: 27819266
• UniProt: Q9V0G8|RS19E_PYRAB Small ribosomal subunit protein eS19 (Gene Name=rps19e)