Structure of PDB 5hkv Chain U

Receptor sequence
>5hkvU (length=42) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
TGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALK
3D structure
PDB5hkv Structural insights of lincosamides targeting the ribosome of Staphylococcus aureus.
ChainU
Resolution3.66 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U R18 H20 A21 L22 N23 W29 A31 N32 L33 Q34 K55 R5 H7 A8 L9 N10 W16 A18 N19 L20 Q21 K42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hkv, PDBe:5hkv, PDBj:5hkv
PDBsum5hkv
PubMed28973455
UniProtQ2FZ60|RL28_STAA8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]