Structure of PDB 5apn Chain U

Receptor sequence
>5apnU (length=102) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
IAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTEDG
TVVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFYQV
TP
3D structure
PDB5apn Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
ChainU
Resolution3.91 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna U K13 K42 F71 S72 G73 K74 Y75 K77 Y78 K81 K82 K85 K86 R90 R94 S97 T100 Y103 K3 K32 F61 S62 G63 K64 Y65 K67 Y68 K71 K72 K75 K76 R80 R84 S87 T90 Y93
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5apn, PDBe:5apn, PDBj:5apn
PDBsum5apn
PubMed26709046
UniProtP05749|RL22A_YEAST Large ribosomal subunit protein eL22A (Gene Name=RPL22A)

[Back to BioLiP]