Structure of PDB 4qlc Chain U

Receptor sequence
>4qlcU (length=76) Species: 9031 (Gallus gallus) [Search protein sequence]
SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLS
IRRLLAAGVLKQTKGVGASGSFRLAK
3D structure
PDB4qlc Structural Mechanisms of Nucleosome Recognition by Linker Histones.
ChainU
Resolution3.503 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna U H25 T27 Y28 R42 S46 Q48 R74 K85 G91 S92 H4 T6 Y7 R21 S25 Q27 R53 K64 G70 S71 PDBbind-CN: Kd=0.35uM
BS02 dna U R47 L66 K69 R73 A89 S90 R94 R26 L45 K48 R52 A68 S69 R73 PDBbind-CN: Kd=0.35uM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qlc, PDBe:4qlc, PDBj:4qlc
PDBsum4qlc
PubMed26212454
UniProtP02259|H5_CHICK Histone H5

[Back to BioLiP]