Structure of PDB 4ce4 Chain U

Receptor sequence

>4ce4U (length=123) Species: 9825 (Sus scrofa domesticus)

LRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRL
KKRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYE
PKTFKSLAALAKRRRPPPPPPPP

3D structure

• PDB: 4ce4 Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome.
• Chain: U
• Resolution: 4.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	L10 R11 R13 D16 R17 R20 H30 F31 R32 R34 K35 C38 R40 R44 R48 A49 K52 C53 R55 K60 K61 R62 R65 I69 P84 I88 N98 R99 K100	L1 R2 R4 D7 R8 R11 H21 F22 R23 R25 K26 C29 R31 R35 R39 A40 K43 C44 R46 K51 K52 R53 R56 I60 P75 I79 N89 R90 K91

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 09:28:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4ce4', asym_id = 'U', title = 'Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4ce4', asym_id='U', title='Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4ce4', asym_id = 'U'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4ce4', asym_id='U')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>