Structure of PDB 3jbn Chain U

Receptor sequence

>3jbnU (length=149) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

RMYGKGKGISSSTLPYKRKQPSWLKQKPSEIEDAIIKLAKKGQTPSQIGA
TLRDNYGIPQVKSVTGNKILRILRAQGIATTIPEDLYFLIKKAVSMRKHL
EKNKKDKDCKFRLILTESKIHRISRYYKRKKLLPSNWKYQSSTASALIA

3D structure

PDB

3jbn Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

4.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	R3 M4 Y5 K7 K9 G10 I11 S12 S13 S14 T15 L16 R20 P47 S48 G51 R55 P61 K64 K70 I71 L72 R73 R76 D87 F90 K94 M98 H101 N105 K106 K107 D108 K109 D110 K112 F113 R114 K121 R124 R127 Y128 R131 K132 K133	R1 M2 Y3 K5 K7 G8 I9 S10 S11 S12 T13 L14 R18 P45 S46 G49 R53 P59 K62 K68 I69 L70 R71 R74 D85 F88 K92 M96 H99 N103 K104 K105 D106 K107 D108 K110 F111 R112 K119 R122 R125 Y126 R129 K130 K131
BS02	rna	U	H123 K140	H121 K138

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbn, PDBe:3jbn, PDBj:3jbn
PDBsum	3jbn
PubMed	26432834
UniProt	Q8IDB0

[Back to BioLiP]