Structure of PDB 3j79 Chain U

Receptor sequence

>3j79U (length=180) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

IDNSLNTNIHQYHIVGRAIPTAKDKNPNVYRMCIFAKNDTNAKSRFWYFM
KKINKLKKSNGELLACEQIKERFPLRVKNYGVLLRYDSRTGTHNMYKEFR
DTTKEGAIAQLYSEMAGRHRARASSINIIRISEISSSLVRRPHIKQLLKR
RLRFPALHLPTLQKEYRKKFASKRPSTYRM

3D structure

PDB

3j79 Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	U	S8 N10 N12 K41 K74 F77 R80 S92 R93 T94 H97 M99 Y100 S117 E118 A120 G121 R122 H123 R124 R126 E137 S139 L142 R145 R154 R155 R157 L161 L163 K168 Y170 R171 K172 S176 K177 R178 P179 S180 T181 Y182 M184	S4 N6 N8 K37 K70 F73 R76 S88 R89 T90 H93 M95 Y96 S113 E114 A116 G117 R118 H119 R120 R122 E133 S135 L138 R141 R150 R151 R153 L157 L159 K164 Y166 R167 K168 S172 K173 R174 P175 S176 T177 Y178 M180
BS02	rna	U	R49 Y52 K55 K56 I57 K59 K61 R126	R45 Y48 K51 K52 I53 K55 K57 R122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j79, PDBe:3j79, PDBj:3j79
PDBsum	3j79
PubMed	24913268
UniProt	Q8IDS6

[Back to BioLiP]