Structure of PDB 3j47 Chain U

Receptor sequence

>3j47U (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

IRLTNQLKSLKGLQSKLKDVVEYLDKVIHTILGKLQDVFNLNNLQKALTV
KTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKD

3D structure

PDB

3j47 Formation of an Intricate Helical Bundle Dictates the Assembly of the 26S Proteasome Lid.

Chain

Resolution

7.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	U	L190 Q193 L197 L200 L204 V207 L211 L226 L229 Q230 F233	L3 Q6 L10 L13 L17 V20 L24 L32 L35 Q36 F39
BS02	peptide	U	V282 I285 I286 D289 I292 E293 I296 Q297 K300	V65 I68 I69 D72 I75 E76 I79 Q80 K83
BS03	peptide	U	M274 I285 F288 I292	M57 I68 F71 I75
BS04	peptide	U	N270 M274 I276 Y277 I278 N280 L281 S284 F288 L291 I292 N294 K295	N53 M57 I59 Y60 I61 N63 L64 S67 F71 L74 I75 N77 K78
BS05	peptide	U	N280 S284	N63 S67

External links

PDB	RCSB:3j47, PDBe:3j47, PDBj:3j47
PDBsum	3j47
PubMed	23911091
UniProt	Q08723\|RPN8_YEAST 26S proteasome regulatory subunit RPN8 (Gene Name=RPN8)