Structure of PDB 8rdw Chain To

Receptor sequence

>8rdwTo (length=87) Species: 45610 (Psychrobacter urativorans)

ANTAQARKRARQNTKRRQNSASQRSMVRTYLKRVDAAIAAKDYDAATEAY
KKAIPVLDRMADKGIIHKNKAARRKSRLNKTIKGLQA

3D structure

• PDB: 8rdw A new family of bacterial ribosome hibernation factors
• Chain: To
• Resolution: 2.74 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	To	A2 N3 Q6 K9 R10 R12 Q13 N14 R17 R18 S23 R25 S26 M27 R29 T30 K33 R34 Y44 I55 P56 D59 R60 D63 K64 H68 K71 A73 R74 R75 K76 S77 R78 N80 K84	A1 N2 Q5 K8 R9 R11 Q12 N13 R16 R17 S22 R24 S25 M26 R28 T29 K32 R33 Y43 I54 P55 D58 R59 D62 K63 H67 K70 A72 R73 R74 K75 S76 R77 N79 K83

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rdw, PDBe:8rdw, PDBj:8rdw
• PDBsum: 8rdw
• PubMed: 38355796
• UniProt: A0A0M4T3R2