Structure of PDB 7y4l Chain TH

Receptor sequence

>7y4lTH (length=177) Species: 35688 (Porphyridium purpureum)

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

• PDB: 7y4l In situ structure of the red algal phycobilisome-PSII-PSI-LHC megacomplex.
• Chain: TH
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	TH	N72 C73 R77 R78 A81 C82 R84 D85 I88 L113 L120 V122	N72 C73 R77 R78 A81 C82 R84 D85 I88 L113 L120 V122
BS02	PEB	TH	C50 D54 C61 I133 Q137 F141 A146 T147 E148	C50 D54 C61 I133 Q137 F141 A146 T147 E148
BS03	PEB	TH	N35 K36 D39 I142 F153 A154 A155 G156 C158	N35 K36 D39 I142 F153 A154 A155 G156 C158
BS04	PEB	TH	N76 M79	N76 M79

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:7y4l, PDBe:7y4l, PDBj:7y4l
• PDBsum: 7y4l
• PubMed: 36922595
• UniProt: P11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)