Structure of PDB 6bok Chain TB

Receptor sequence
>6bokTB (length=137) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVI
RIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLY
FIRNLSDREIRRKLRADRKRIDKDRAAERAAKEEVQK
3D structure
PDB6bok Conformational Control of Translation Termination on the 70S Ribosome.
ChainTB
Resolution3.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna TB R41 Q43 S106 R108 R111 R118 K119 D122 R41 Q43 S106 R108 R111 R118 K119 D122
BS02 rna TB N2 R3 G4 R23 R51 R53 R54 N55 G56 N58 I75 R95 R96 A97 K98 Y100 F101 K113 K119 N2 R3 G4 R23 R51 R53 R54 N55 G56 N58 I75 R95 R96 A97 K98 Y100 F101 K113 K119
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6bok, PDBe:6bok, PDBj:6bok
PDBsum6bok
PubMed29731232
UniProtQ72JU9|RL19_THET2 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]