Structure of PDB 6vmi Chain TA

Receptor sequence

>6vmiTA (length=45) Species: 9606 (Homo sapiens) [Search protein sequence]

EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTL

3D structure

PDB

6vmi Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.

Chain

Resolution

2.96 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	TA	K63 I64 L67 V68 A72 L85	K18 I19 L22 V23 A27 L40

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006390	mitochondrial transcription
GO:0006412	translation
GO:0032543	mitochondrial translation
GO:0045893	positive regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005759	mitochondrial matrix
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6vmi, PDBe:6vmi, PDBj:6vmi
PDBsum	6vmi
PubMed	32737313
UniProt	P52815\|RM12_HUMAN Large ribosomal subunit protein bL12m (Gene Name=MRPL12)