Structure of PDB 7r81 Chain T2

Receptor sequence

>7r81T2 (length=141) Species: 5141 (Neurospora crassa)

FNHILRLLNTNVDGKQKVVYSLTKIKGVGRRYSNLVCKKADVDLSKRAGE
LTSEELERIVTIMQNPTAYKIPAWFLNRQRDIVDGKDSQILANGVDSKLR
DDLERLKKIRAHRGLRHYWGLRVRGQHTKTTGRRGRTVGVS

3D structure

• PDB: 7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
• Chain: T2
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T2	Q26 K27 Y30 K36 G37 V38 G39 R40 R41 Y42 R57 W84 F85 N87 R88 Q89 H122 R123 H127 R132 V133 R134 G135 Q136 H137 T138 K139 T140 T141 G142 R143 R144 G145 R146 V148	Q16 K17 Y20 K26 G27 V28 G29 R30 R31 Y32 R47 W74 F75 N77 R78 Q79 H112 R113 H117 R122 V123 R124 G125 Q126 H127 T128 K129 T130 T131 G132 R133 R134 G135 R136 V138

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7r81, PDBe:7r81, PDBj:7r81
• PDBsum: 7r81
• PubMed: 34815343
• UniProt: Q7RXX0