Structure of PDB 6gzq Chain T2

Receptor sequence
>6gzqT2 (length=99) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMR
KAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
3D structure
PDB6gzq Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainT2
Resolution3.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna T2 R8 L10 K14 R15 Q18 R22 N26 S31 T35 R57 S61 D64 K65 S70 R79 R83 M85 R89 G102 G103 L104 S105 R1 L3 K7 R8 Q11 R15 N19 S24 T28 R50 S54 D57 K58 S63 R72 R76 M78 R82 G95 G96 L97 S98
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6gzq, PDBe:6gzq, PDBj:6gzq
PDBsum6gzq
PubMed30301898
UniProtP80380|RS20_THET8 Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]