Structure of PDB 8rcs Chain T1

Receptor sequence
>8rcsT1 (length=86) Species: 562 (Escherichia coli) [Search protein sequence]
ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB8rcs Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
ChainT1
Resolution4.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T1 A2 I4 S6 K9 R10 R18 S23 R25 S26 M27 R29 T30 K33 K34 F51 Q55 D59 R60 K64 H68 K69 N70 A73 R74 K76 A77 T80 A1 I3 S5 K8 R9 R17 S22 R24 S25 M26 R28 T29 K32 K33 F50 Q54 D58 R59 K63 H67 K68 N69 A72 R73 K75 A76 T79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rcs, PDBe:8rcs, PDBj:8rcs
PDBsum8rcs
PubMed38409277
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]