Structure of PDB 8x1c Chain T

Receptor sequence
>8x1cT (length=403) Species: 9606 (Homo sapiens) [Search protein sequence]
DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVEGPTYYIDTNALR
VPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAP
WNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATH
TTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASK
EAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDE
QVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVS
HVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSM
RLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVER
KCP
3D structure
PDB8x1c Structure of nucleosome-bound SRCAP-C in the ADP-bound state
ChainT
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP T G19 S20 Y21 R24 G173 A174 A264 G353 N354 G11 S12 Y13 R16 G147 A148 A238 G327 N328
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0000723 telomere maintenance
GO:0001825 blastocyst formation
GO:0003407 neural retina development
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006282 regulation of DNA repair
GO:0006310 DNA recombination
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007165 signal transduction
GO:0007399 nervous system development
GO:0008284 positive regulation of cell population proliferation
GO:0021510 spinal cord development
GO:0030071 regulation of mitotic metaphase/anaphase transition
GO:0033044 regulation of chromosome organization
GO:0042981 regulation of apoptotic process
GO:0045582 positive regulation of T cell differentiation
GO:0045596 negative regulation of cell differentiation
GO:0045597 positive regulation of cell differentiation
GO:0045663 positive regulation of myoblast differentiation
GO:0045739 positive regulation of DNA repair
GO:0045893 positive regulation of DNA-templated transcription
GO:0045995 regulation of embryonic development
GO:0051726 regulation of cell cycle
GO:0060382 regulation of DNA strand elongation
GO:0070316 regulation of G0 to G1 transition
GO:1902459 positive regulation of stem cell population maintenance
GO:1904507 positive regulation of telomere maintenance in response to DNA damage
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000045 regulation of G1/S transition of mitotic cell cycle
GO:2000779 regulation of double-strand break repair
GO:2000781 positive regulation of double-strand break repair
GO:2000819 regulation of nucleotide-excision repair
Cellular Component
GO:0000776 kinetochore
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005886 plasma membrane
GO:0016363 nuclear matrix
GO:0016514 SWI/SNF complex
GO:0016586 RSC-type complex
GO:0031011 Ino80 complex
GO:0032991 protein-containing complex
GO:0035060 brahma complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0071564 npBAF complex
GO:0140288 GBAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x1c, PDBe:8x1c, PDBj:8x1c
PDBsum8x1c
PubMed38331872
UniProtO96019|ACL6A_HUMAN Actin-like protein 6A (Gene Name=ACTL6A)

[Back to BioLiP]