Structure of PDB 8ury Chain T

Receptor sequence
>8uryT (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
3D structure
PDB8ury Structural basis of RfaH-mediated transcription-translation coupling
ChainT
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T S2 D21 T22 G23 Q28 H38 L39 H42 H46 K48 D49 H50 H51 S52 R54 R58 S61 K65 Y69 R72 K73 S1 D20 T21 G22 Q27 H37 L38 H41 H45 K47 D48 H49 H50 S51 R53 R57 S60 K64 Y68 R71 K72
BS02 rna T Q40 R88 Q39 R87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ury, PDBe:8ury, PDBj:8ury
PDBsum8ury
PubMed39117885
UniProtC3SSQ7

[Back to BioLiP]