Structure of PDB 8s1p Chain T

Receptor sequence
>8s1pT (length=91) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
KDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVKV
DKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEI
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
ChainT
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T T14 R16 K25 R33 N35 K36 T37 E38 K53 N55 I56 M57 N58 Y59 K60 K62 V66 Y69 T70 G71 S74 R75 R77 K78 I80 K82 T13 R15 K24 R32 N34 K35 T36 E37 K52 N54 I55 M56 N57 Y58 K59 K61 V65 Y68 T69 G70 S73 R74 R76 K77 I79 K81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP42924|RL23_BACSU Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]