Structure of PDB 8r57 Chain T

Receptor sequence

>8r57T (length=140) Species: 4565 (Triticum aestivum) [Search protein sequence]

STARTVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPSDA
DWYYIRAASMARKIYLRQGIGIGGFQKIYGGRQRNGSRPPHFCKSSGAVS
RNILQELQKMGIIDVDPKGGRLITSQGRRDLDQVAGTVPA

3D structure

PDB

8r57 High-Resolution Structure and Internal Mobility of a Plant 40S Ribosomal Subunit.

Chain

Resolution

2.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	A16 H25 V28 V50 T52 R54 K56 E57 P60 R69 S72 R75 R80 Q81 I83 G84 I85 K90 I91 R95 Q96 R97 G99 S100 R101 P102 P103 H104 F105 K107 S109 G110 A111 R114 Q118 G133 R134 S138 R141 R142 D145	A3 H12 V15 V37 T39 R41 K43 E44 P47 R56 S59 R62 R67 Q68 I70 G71 I72 K77 I78 R82 Q83 R84 G86 S87 R88 P89 P90 H91 F92 K94 S96 G97 A98 R101 Q105 G120 R121 S125 R128 R129 D132

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links