Structure of PDB 8q1p Chain T

Receptor sequence
>8q1pT (length=88) Species: 9913 (Bos taurus) [Search protein sequence]
SDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEI
IMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
3D structure
PDB8q1p Molecular mechanism of the ischemia-induced regulatory switch in mammalian complex I
ChainT
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 EHZ T S44 L45 S44 L45
Gene Ontology
Molecular Function
GO:0000035 acyl binding
GO:0000036 acyl carrier activity
GO:0005504 fatty acid binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016491 oxidoreductase activity
GO:0140978 mitochondrial large ribosomal subunit binding
Biological Process
GO:0006120 mitochondrial electron transport, NADH to ubiquinone
GO:0006633 fatty acid biosynthetic process
GO:0032981 mitochondrial respiratory chain complex I assembly
GO:0044571 [2Fe-2S] cluster assembly
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0031966 mitochondrial membrane
GO:0045271 respiratory chain complex I
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q1p, PDBe:8q1p, PDBj:8q1p
PDBsum8q1p
PubMed38870289
UniProtP52505|ACPM_BOVIN Acyl carrier protein, mitochondrial (Gene Name=NDUFAB1)

[Back to BioLiP]