Structure of PDB 8p2f Chain T

Receptor sequence

>8p2fT (length=116) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

PRVKGGTVTRARRKKTIKLAKGYFGSKHTLYKVAKQQVMKSGQYAFRDRR
QRKRDFRKLWITRINAAARQHEMSYSRLMNGLKKAGIDINRKMLSEIAIS
DEKAFAQLVTKAKDAL

3D structure

PDB

8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid

Chain

Resolution

2.44 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	P2 R3 V4 K5 G6 T8 T10 R11 R13 R14 K15 K16 K19 K22 G23 Y24 F25 G26 S27 H29 T30 L31 Y32 K33 K36 Q37 Q38 K41 S42 Y45 A46 F47 R48 D49 R50 R51 Q52 R53 K54 R55 F57 R58 K59 W61 I62 N66 R70 Y76 S77 N81 N91 R92 K93	P1 R2 V3 K4 G5 T7 T9 R10 R12 R13 K14 K15 K18 K21 G22 Y23 F24 G25 S26 H28 T29 L30 Y31 K32 K35 Q36 Q37 K40 S41 Y44 A45 F46 R47 D48 R49 R50 Q51 R52 K53 R54 F56 R57 K58 W60 I61 N65 R69 Y75 S76 N80 N90 R91 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum	8p2f
PubMed	38902339
UniProt	Q2FXQ1\|RL20_STAA8 Large ribosomal subunit protein bL20 (Gene Name=rplT)