Structure of PDB 8ovj Chain T

Receptor sequence

>8ovjT (length=152) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

THYSRKPQVSSKSAKAKVSDLRCHYKNTFETANVINGMPLRKAQQLYRQV
LAKTRCIPFKRYNGKIGRTAQAKEWGQTKGRWPRKSVVAMMSLLKNAEAN
AIEKGLDPNQMVIKHVQVDQAARMRRRTYRAHGRITPYMCSPCHVQLFMS
EK

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	T	T2 K18 R23 H25 K27 F30 R42 Q46 R49 Q50 L52 R62 G65 K66 R82 R85 M92 N97 N101 Q118 V119 R124 R127 T129 R131 A132 H133	T1 K17 R22 H24 K26 F29 R41 Q45 R48 Q49 L51 R61 G64 K65 R81 R84 M91 N96 N100 Q117 V118 R123 R126 T128 R130 A131 H132
BS02	rna	T	R69 A71 Q72 K74	R68 A70 Q71 K73
BS03	rna	T	T2 S5 R62	T1 S4 R61
BS04	rna	T	H25 K66 G68 R69 R82 W83 R85 K86 Y130 R131 I136 T137 P138 Y139 M140 C141	H24 K65 G67 R68 R81 W82 R84 K85 Y129 R130 I135 T136 P137 Y138 M139 C140

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	Q4QAX6

[Back to BioLiP]