Structure of PDB 8olt Chain T

Receptor sequence

>8oltT (length=78) Species: 10090 (Mus musculus) [Search protein sequence]

LTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAME
DEFGFEIPDIDAEKLMCPQEIVDYIADK

3D structure

PDB

8olt Investigation of hydrated channels and proton pathways in a high-resolution cryo-EM structure of mammalian complex I.

Chain

Resolution

2.84 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EHZ	T	S44 L45	S39 L40

Gene Ontology

	Molecular Function
GO:0140978	mitochondrial large ribosomal subunit binding

	Biological Process
GO:0006633	fatty acid biosynthetic process
GO:0009060	aerobic respiration
GO:0009249	protein lipoylation
GO:0016226	iron-sulfur cluster assembly
GO:0019752	carboxylic acid metabolic process
GO:0032981	mitochondrial respiratory chain complex I assembly
GO:0042776	proton motive force-driven mitochondrial ATP synthesis
GO:0044571	[2Fe-2S] cluster assembly

	Cellular Component
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0045271	respiratory chain complex I
GO:0099128	mitochondrial [2Fe-2S] assembly complex
GO:1902494	catalytic complex
GO:1990229	iron-sulfur cluster assembly complex

External links

PDB	RCSB:8olt, PDBe:8olt, PDBj:8olt
PDBsum	8olt
PubMed	37531432
UniProt	Q9CR21\|ACPM_MOUSE Acyl carrier protein, mitochondrial (Gene Name=Ndufab1)