Structure of PDB 8k3o Chain T

Receptor sequence
>8k3oT (length=85) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKL
3D structure
PDB8k3o Cryo-EM structure of 30S ribosome with cleaved AP-mRNA bound complex I
ChainT
Resolution3.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T A2 N3 I4 S6 R10 S14 K16 R18 H20 N21 R24 Y36 Q55 D59 H68 N70 K71 R74 H75 K76 T80 A1 N2 I3 S5 R9 S13 K15 R17 H19 N20 R23 Y35 Q54 D58 H67 N69 K70 R73 H74 K75 T79
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k3o, PDBe:8k3o, PDBj:8k3o
PDBsum8k3o
PubMed
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]