Structure of PDB 8eyq Chain T

Receptor sequence
>8eyqT (length=86) Species: 562 (Escherichia coli) [Search protein sequence]
ANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAF
NEMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA
3D structure
PDB8eyq KsgA facilitates ribosomal small subunit maturation by proofreading a key structural lesion.
ChainT
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T A2 N3 I4 S6 R10 R18 N21 S26 R29 T30 K33 Q55 R60 H68 N70 K71 R74 K76 A1 N2 I3 S5 R9 R17 N20 S25 R28 T29 K32 Q54 R59 H67 N69 K70 R73 K75
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008073 ornithine decarboxylase inhibitor activity
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eyq, PDBe:8eyq, PDBj:8eyq
PDBsum8eyq
PubMed37653244
UniProtP0A7U7|RS20_ECOLI Small ribosomal subunit protein bS20 (Gene Name=rpsT)

[Back to BioLiP]