Structure of PDB 8cf5 Chain T

Receptor sequence

>8cf5T (length=119) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA

3D structure

PDB

8cf5 Cryo-EM analysis of eukaryotic ribosome translocation intermediates

Chain

Resolution

2.71 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	G72 Y75 R81 R86 R90 T93 K94 F95 E102 K103 K106 K107 I109 K115	G71 Y74 R80 R85 R89 T92 K93 F94 E101 K102 K105 K106 I108 K114
BS02	rna	T	K5 A6 Y7 R10 S40 P42 K45 R48 K49 A52 C53 L55 T56 N59 E60 R63 R67 K78 K83 T85 R86 R89	K4 A5 Y6 R9 S39 P41 K44 R47 K48 A51 C52 L54 T55 N58 E59 R62 R66 K77 K82 T84 R85 R88

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8cf5, PDBe:8cf5, PDBj:8cf5
PDBsum	8cf5
PubMed	38030725
UniProt	P0CX84\|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)