Structure of PDB 8cee Chain T

Receptor sequence
>8ceeT (length=95) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAY
EINDFRDGFYQIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKEEE
3D structure
PDB8cee Structural basis of ribosomal 30S subunit degradation by RNase R
ChainT
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna T Y4 Q73 K80 R87 V90 V91 K92 Y4 Q73 K80 R87 V90 V91 K92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cee, PDBe:8cee, PDBj:8cee
PDBsum8cee
PubMed38326618
UniProtP21468|RS6_BACSU Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]