Structure of PDB 8azw Chain T

Receptor sequence

>8azwT (length=114) Species: 4097 (Nicotiana tabacum)

VQRLTYRKRHSYATKSNQHRVVKTPGGKLIYQSTKKRASGPKCPVTGKRI
QGIPHLRPTEYKRSRLSRNRRTVNRAYGGVLSGSAVRERIIRAFLVEEQK
IVKKVLKIQKAKEK

3D structure

• PDB: 8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
• Chain: T
• Resolution: 2.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	T	V2 R4 L5 T6 Y7 R8 K9 R10 H11 S12 Y13 T15 S17 R21 V22 K24 T25 P26 G27 K29 L30 Y32 Q33 T35 K36 K37 R38 S40 K43 P45 K49 R50 Q52 G53 P55 H56 R58 P59 T60 Y62 K63 R64 S65 R66 R69 N70 R71 R72 N75 R76 Y78 G79 V81 R90 R93 A94 V97 E98 Q100 K101	V1 R3 L4 T5 Y6 R7 K8 R9 H10 S11 Y12 T14 S16 R20 V21 K23 T24 P25 G26 K28 L29 Y31 Q32 T34 K35 K36 R37 S39 K42 P44 K48 R49 Q51 G52 P54 H55 R57 P58 T59 Y61 K62 R63 S64 R65 R68 N69 R70 R71 N74 R75 Y77 G78 V80 R89 R92 A93 V96 E97 Q99 K100

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8azw, PDBe:8azw, PDBj:8azw
• PDBsum: 8azw
• PubMed: 37156858
• UniProt: P41098|RL34_TOBAC Large ribosomal subunit protein eL34 (Gene Name=RPL34)